This user guide is meant for ClientCare Version v1.4.
Too many clients to keep track of? Not sure when is your next appointment? Fret not! ClientCare is a desktop application for assisting insurance agents in managing their client relationships and follow-ups effectively. Built with your needs in mind, ClientCare is here to help you manage all your clients, appointments and policies, all in one place!
New to ClientCare? We recommend you to check out the Using this guide section to get you started. Ready to head straight into the action? You can refer to our Quick Start section to set ClientCare up.
This guide walks you through all the features of ClientCare and can be used as a quick reference whenever you need any help. If you're just getting started with ClientCare, we welcome you to start from our Introducing ClientCare section to learn more about the app. For setting up ClientCare, you might find the Quick Start section helpful.
Ready to use ClientCare? You can check out our Features section. For ease of reference, the Features section is divided into subsections corresponding to each main feature: Clients, Schedules and Policies. Feel free to jump around as you explore ClientCare's amazing features!
Need a quick refresher? You can head to the Command Summary for a quick recap!
Unsure of any terms? You can take a look at the Glossary section.
You can also refer to our Table of Contents to navigate between the different sections of this guide.
This guide does not assume any technical knowledge from users. Typing on a keyboard is all you need to know! ClientCare uses a Text Command Box to interact with users. Not sure how to use it? No worries, we got you covered. You can head over to the Text Command Introduction for a quick breakdown.
If you are familiar with how text commands work, good news! Using ClientCare will be a breeze for you.
Formatting Conventions 
As you read through the guide, you might come across different text formats, and wonder what they mean. Here is a quick rundown of the conventions we use!
| Format | Description | 
|---|---|
| blue hyperlink | Blue hyperlinks bring you to another section of the user guide or another website for more relevant information. | 
| command | Text in a monospace font and grey box are ClientCare commands. Refer to ClientCare Commands for more details. | 
| FIELD | Upper case text in a monospace font are fields to input with ClientCare commands. Each command has unique fields, which you can find under Features. | 
Call-out Text-box Conventions
You might encounter these call-outs while reading through the guide, which contain additional information for using ClientCare.
Tip: Tip call-outs like this contain helpful pointers for using ClientCare!
Note: Information call-outs like this contain information about ClientCare you should take note of!
CAUTION: Caution call-outs like this contain warnings you should remember when using ClientCare to avoid errors!
Made for insurance agents and clients, by insurance agents and clients. ClientCare is the easiest way to manage your clients and schedules, all in one place. Powerful features and intuitive design, all packaged into one neat desktop app. ClientCare is supported on all major platforms (Windows, macOS).
Managing your clients ClientCare lets you store, edit and delete your client's information. Keep all your clients' details in one place and save time!
Planning your schedule Meeting clients are part of the job. Not sure when to meet your next client? ClientCare reminds you of clients that you may have missed out!
Keeping track of policies Too many policies from different companies? Why not track all of them in one place! ClientCare allows you to attach policies to all your clients, regardless of companies and product type.
Let's get started with ClientCare. This section will help you get familiar with how ClientCare works, from installation to using ClientCare.
Don't have ClientCare installed on your computer yet? Check out our step-by-step installation instructions to download ClientCare.
ClientCare is written in the programming language Java, so you'll need Java 11 or above installed in your computer to run ClientCare.
Download the latest version of ClientCare by downloading the clientcare.jar file found here.
Note: The ClientCare application file can be found at the bottom of the release notes, under Assets!
Create a new empty folder (with any name you like) in your computer where you'd like to store ClientCare.
Copy the downloaded ClientCare file (clientcare.jar) into the new folder.
And...that's it! You now have ClientCare installed on your laptop!
Refer to the Features below for details of each command.
Congrats! With ClientCare downloaded (if not, our installation instructions might be useful), let's get started!
These are the platforms we currently support ClientCare on:
clientcare.jar.If you are facing issues opening the app, you can find an alternative solution here.
clientcare.jar.clientcare.jar to start the application.

If you are facing issues opening the app, you can find an alternative solution here.
Now that we got ClientCare up and running, let's get you familiar with its display. You will learn how the different parts of ClientCare look and work in this section.
ClientCare has 6 components in its display. Different commands affect parts of the Display. You can refer to the Quick Tutorial to see how the different parts of the display change when entering commands!
ClientCare works through text commands. Instead of clicking buttons, you tell ClientCare what to do by typing!
These commands must be formatted in a specific way or ClientCare will not understand what you are saying. Let's learn the language that ClientCare speaks in.
A ClientCare command can be made up of the following parts:
This keyword tells ClientCare what you want to do. If you want to add a new client, then add will be the keyword.
All commands must start with a keyword.
Some commands may involve an index, indicated in command formats as INDEX. This is simply a number which is assigned to a particular Client.
For example, the first client in the list will have the index 1.
The index can take on values from 1 to the number of clients shown in the Client List. It will never be 0 or a negative number.
Some commands have fields associated with them. For example, when you are adding a client, you need to add his name too. His name will be considered a field, similarly for Date of Birth, Address etc.
Here are some things to take note of when using them!
n/ and date has d/. The command format will show what field a prefix is referring to in uppercase, like n/NAME, in case you forget![a/ADDRESS].[t/TAG]..., meaning you can use multiple of them, so you can have both t/friend t/drives in one command.clear will do! If any extraneous fields are present for these commands, they will be ignored.
For example, clear 1 and clear all will both be interpreted as clear.The full list of commands and their formats can be found under the Features section. Alternatively, Command Summary has all of them under one page for a quick reference.
CAUTION: If you are using a PDF version of this document, be careful when copying and pasting commands that span multiple lines as the command format may be copied over incorrectly.
While using ClientCare, you may encounter errors when you mistype or missed something out in your commands. Not to worry, you will learn how to handle these error messages with ease in this section.
There are 4 types of error messages you may encounter in the Feedback Display.
This occurs when you have mis-spelt the command keyword or the keyword does not exist. If you do not remember what are the command keywords available, you can easily refer them again under Command Summary.
This occurs when you have missed certain required fields or prefixes in the commands.
For example: adding a policy to a client requires an index, policy name and policy ID. Missing any one of these will throw an invalid command format error.
addpolicy 1 i/02141 will cause an error as you have missed out the n/ prefix and its input value.
This occurs when you have all the prefixes required in a command but may have typed an invalid value. There are 2 possible situations where this is possible.
edit 2 c/123vad43 causes invalid field format error.met even though your date format is correct.
If today is 5 Jan 2024, typing met 2 d/2024-10-08 which is 8 Oct 2024 will cause an invalid field value error.This occurs when you gave ClientCare an index value that is larger than your current client list.
For example: If you only have 7 clients, then your index should be a value from 1 to 7.
edit 27 n/Bob will cause an error as you have less than 27 clients.
Note: ClientCare will only show you one error message at a time. If you have multiple errors, not to worry! ClientCare will be with you to correct each error!
Excited to play around with ClientCare? Let’s run you through some simple commands to get you warmed up before you dive right into ClientCare’s full feature list!
Note: Your ClientCare may look different upon starting up. This is because the client data stored within the app may be different.
Let's boot up ClientCare and get started!
Type the following into the Command Input:
add n/James Wee c/98765432 e/james@hotmail.com a/East Coast Blk 112 d/1998-05-25 p/vip
7.
When this guide was released, today was 11 April 2024. Hence, let's set the appointment at 18 April 2024 2pm.
Let's type the following command into the Command Input:schedule 7 d/2024-04-18 14:00
Note: Since you cannot schedule an appointment for a date and time that has passed or that exact moment, do change the date field as needed.
ClientCare will show us the error along with the correct command format in the Feedback Display.
Note: The Feedback Display may be unable to show the entire error message at once. You can scroll down in the Feedback Display to see the whole message. All error messages due to invalid formatting will end with an example.
Dive right into ClientCare's full list of features. This section guides you through all of ClientCare's commands.
For easy reference, similar features are grouped into the same subsections as shown below:
ClientCare is all about managing your clients. ClientCare will help you keep track of all your clients and their details, so you never have to lose a contact again.
ClientCare offers the following commands to help you manage your clients:
adddeleteeditlistviewfindremarkclearsort addThe first step for any insurance agent is to find clients! You can add your new client to the client list with add.
Format: add n/NAME c/PHONE_NUMBER e/EMAIL a/ADDRESS d/BIRTHDAY p/PRIORITY [t/TAG]…
Note: A client can have any number of tags (including 0). For example, t/owesMoney t/friends is allowed.
All other fields (except for tags) cannot have duplicate fields. For example, c/1234567 c/7654321 is not allowed.
Note: The name of the client is case-sensitive. John and john will be regarded as different people.
Fields usage for client details:
| Field | Usage | Example | 
|---|---|---|
| 'n/NAME' | All names in the system must be unique and names are case sensitive | n/John Doe | 
| 'c/PHONE_NUMBER' | Phone numbers should only contain numbers, and it should be at least 3 digits long | c/98765432 | 
| 'e/EMAIL' | Email should be in the format of local-part@domain | e/johndoe@email.com | 
| 'a/ADDRESS' | Address can take any text value | a/311, Clementi Ave 2, #02-25 | 
| 'd/BIRTHDAY' | Birthday should be in the format of YYYY-MM-DD | d/1990-01-01 | 
| 'p/PRIORITY' | Priority can be low,medium,high,vip, orl,m,h,v(Case Insensitive) | p/medium,p/MEDIUM,p/m,p/M | 
| 't/TAG' | Tags can be any text value | t/friends | 
Examples:
add n/John Doe c/98765432 e/johnd@example.com a/311, Clementi Ave 2, #02-25 d/1990-01-01 p/low t/friends t/owesMoneyadd n/Betsy Crowe t/friend p/vip e/betsycrowe@example.com a/Hougang Road 12 c/1234567 t/buddy d/1979-03-04Tip: If you are missing information for some fields, you can enter placeholder values like e/placeholder@email.com!
Before Command:
Suppose you just met a new client! Let's add James Wee to your client list and his following details:
Type the following into the Command Input:
add n/James Wee c/98765432 e/james@hotmail.com a/East Coast Blk 112 d/1998-05-25 p/vip
After Command:
You have now added James Wee to our Client List! ClientCare shows a success message in the Feedback Display too.
deleteWhile you can have new clients, it is also possible to lose existing clients. Hopefully, that does not happen often!
You can delete a specified client from the client list with delete.
Format: delete INDEX
INDEX.Examples:
list followed by delete 2 deletes the 2nd client in the client list.find Betsy followed by delete 1 deletes the 1st client in the results of the find command.Before Command:
Suppose David Li is no longer your client. He is number 4 on our client list as seen on the left.
Type the following into the Command Input: delete 4
After Command:
You have now removed David Li from our client list! ClientCare shows a success message in the Feedback Display too.
editClient information is always changing! If you ever need to update your client's particulars, you can edit an existing client with edit.
Format: edit INDEX [n/NAME] [c/PHONE] [e/EMAIL] [a/ADDRESS] [d/BIRTHDAY] [p/PRIORITY] [t/TAG]…
INDEX. The index refers to the index number shown in the displayed client list. The index must be a positive integer 1, 2, 3, …t/ without
specifying any tags after it.Examples:
edit 1 c/91234567 e/johndoe@example.com Edits the phone number and email address of the 1st client to be 91234567 and johndoe@example.com respectively.edit 2 n/Betsy Crower t/ Edits the name of the 2nd client to be Betsy Crower and clears all existing tags.Before Command:
Suppose you want to edit James Wee's name. He is number 7 on our client list as seen on the left.
Type the following into the Command Input: edit 7 n/James Wee Tan Pi
After Command:
You have updated James' name! ClientCare shows a success message in the Feedback Display too.
listAfter applying certain filter or finding commands, you can see all your clients again with list.
Format: list
list all will be interpreted as list.Before Command:
Suppose after finding or filtering clients, you want to see all our clients again.
Type the following into the Command Input: list
After Command:
All your clients are now listed on the client list! ClientCare shows a success message in the Feedback Display too.
viewThere are times when you would want to view a client's details and his policies in detail. You can do so with view.
Format: view INDEX
INDEX.Examples:
list followed by view 2 views the 2nd client in the client list.find Betsy followed by view 1 views the 1st client in the results of the find command.Before Command:
Suppose you want to see Bernice Yu's particulars in greater detail. Bernice Yu is number 2 on the client list.
Type the following into the Command Input: view 2
After Command:
You can now see Bernice Yu's particulars appearing in the Client Display window! ClientCare shows a success message in the Feedback Display too.
findIs your client list too long? You can look for a client with find.
Client whose names contain any of the given keywords will show up!
Format: find KEYWORD [MORE_KEYWORDS]...
hans will match Hans.Hans Bo will match Bo Hans.Han will not match Hans.Examples:
find John returns john and John Doefind alex david returns Alex Yeoh, David LiTip: You can use find to more easily find the client you want for commands that require a client INDEX!
Before Command:
Suppose you want to find James in your client list.
Type the following into the Command Input: find james
After Command:
All clients whose name contains the word "james" will now show up in the client list. ClientCare shows a success message in the Feedback Display too.
remarkNeed to remember certain information about a client such as his preference or health conditions?
You can add notes to each client with remark. If a current remark exists, it will be replaced with the new remark.
Format: remark INDEX [r/REMARK]
INDEX.r/REMARK is not present, or if nothing is typed after r/, the current remark for the client will be removed.Examples:
remark 2 r/Has 2 school-age children and 1 elderly dependent adds a remark for the 2nd client in the client list.remark 1 or remark 1 r/ deletes the remark for the 1st client in the client list.Tip: If you make a typo in your remark, you don't have to delete everything again! Just add a second prefix, for example: remark 1 r/Speeks Enngliish r/Speaks English will only save Speaks English.
Note: ClientCare allows you to put up to about 550 characters for REMARK before characters are truncated in fullscreen. The limit might vary depending on your screen size, so do check if the remark is fully displayed.
Before Command:
Suppose you want to add a note about James that he has diabetes. James is number 6 on the client list.
Type the following into the Command Input: remark 6 r/has diabetes
After Command:
Your new remark about James can now be seen at the Client Display window! ClientCare shows a success message in the Feedback Display too.
clearDo you want to clear the sample clients from ClientCare or start from scratch?
You can clear all the clients from the client list with clear.
Format: clear
clear all will be interpreted as clear.CAUTION: Clearing is irreversible and will NOT have a confirmation screen
Before Command:
Suppose you want to remove all the sample client data from ClientCare.
Type the following into the Command Input: clear
After Command:
ClientCare has been cleared! ClientCare shows a success message in the Feedback Display too.
sortWant to see all your VIP clients first? You can sort the client list with sort:
Format: sort CRITERIA o/ORDER
CRITERIA. Sorting CRITERIA is case-insensitive.CRITERIA can be name, birthday, priority.ORDER is specified by ORDER and can be asc for ascending or desc for descending. Sorting ORDER is case-insensitiveExamples:
sort name o/asc sorts the client list by name in ascending order.sort priority o/desc sorts the client list by priority in descending order.sort birthday o/asc sorts the client list by birthday date in ascending order.Before Command:
Suppose you want to sort the client list by priority where the most important clients appear first.
Type the following into the Command Input: sort priority o/desc
After Command:
Clients of a higher priority will now show up first! ClientCare shows a success message in the Feedback Display too.
Not sure what is happening next? Fear not, ClientCare can help manage your schedule too!
ClientCare reminds you of your upcoming appointments as well as clients you have not met in a while. It also reminds you of your clients' birthday!
Last Met Display: Shows you the list of clients you have not met in a while (that do not have an active schedule). You can set the overdue period using set, which by default is 90 days.
Schedule Display: Shows you the list of clients you have an appointment with.
Birthday Display: Shows you the list of clients whose birthday is within the next 7 days.
ClientCare offers the following commands to help you manage your schedule:
metsetschedulemarkmetJust met up with a client? You can update the last met date you had with your client with met.
Format: met INDEX d/DATE
INDEX.mark on a schedule will not update the last met date.Examples:
met 2 d/2023-05-07 updates the last met date of the 2nd client in the client list to 7 May 2023.met 7 d/2024-07-08 updates the last met date of the 7th client in the client list to 8 July 2024.Note: Clients will only show up in the Last Met Display if the number of days since the last meeting exceeds the period specified. By default, the period is 90 days.
If there is currently a schedule with the client, he will not show up in the Last Met Display. Rather, you will see him under the Schedule Display.
Note: ClientCare will not allow you to meet someone from a future date.
Before Command:
Suppose you just met up with David Li today! David Li is number 4 on the client list.
As of this guide, today is 2024-04-10, 10 April 2024.
Do change the date as required.
Type the following into the Command Input: met 4 d/2024-04-10
After Command:
David Li's last met date has been updated to 10 April 2024! ClientCare shows a success message in the Feedback Display too.
setFeel that 90 days is too short or long of a period? You can set your own desired overdue duration with set.
Format: set NUMBER_OF_DAYS
NUMBER_OF_DAYS.Examples:
set 75 updates the last met overdue duration to 75 days. Clients who you have not met in more than 75 days or
no appointments are scheduled will show up in the Last Met reminder display.Before Command:
Suppose you feel that 90 days is too long, and we want to be reminded to meet all your clients every 30 days.
Type the following into the Command Input: set 30
After Command:
All clients which you have not met in 30 days will be shown in the Last Met Display! ClientCare shows a success message in the Feedback Display too.
scheduleGot a new appointment or a rescheduling is needed?
You can schedule an appointment date and time you have with your client with schedule.
Format: schedule INDEX d/DATETIME
INDEX.Examples:
schedule 2 d/2023-05-07 22:00 schedules an appointment with the
2nd client in the client list at 7 May 2023 10pm.schedule 7 d/2024-07-08 07:30 schedules an appointment with the
7th client in the client list at 8 July 2024 7.30am.Note: ClientCare will only allow you to create a schedule with someone with a valid future date and time.
Tip: ClientCare currently only keeps track of a single schedule with a client at a time.
If you have multiple appointments, you can use the schedule command to update the appointment date and time to the
next appointment after the most recent one is done.
Before Command:
Suppose you want to set an appointment with Roy at 4 June 2024 2pm. Roy is number 6 on the client list. As of this guide, today is 10 April 2024. Hence, you are able to set the appointment on 4 June 2024 2pm.
Remember that you are only able to set a schedule in the future. Do change the appointment data to a future date as required.
Type the following into the Command Input: schedule 6 d/2024-06-04 14:00
After Command:
An appointment with Roy has been made! Notice how Roy's name is removed from Last Met Display and added to Schedule Display. ClientCare shows a success message in the Feedback Display too.
markDone with or need to cancel an appointment?
You can mark an appointment as completed with mark.
Format: mark INDEX
INDEX as completed.Examples:
mark 1 marks the appointment with the
1st client in the client list as completed.Tip: If you have successfully met up with your client, do remember to update the last met date with met!
Before Command:
Suppose you have met up with Roy in the appointment. Roy is number 6 on the client list.
Type the following into the Command Input: mark 6 
After Command:
Your appointment with Roy has been marked as done! ClientCare shows a success message in the Feedback Display too. Notice how Roy's name is removed from Schedule Display and added to Last Met Display. This is because you need to use 'met' to update your Last Met date with Roy.
If your appointment has been cancelled or postponed, you can still use mark. You can leave the Last Met date with Roy unchanged.
Not sure what policies your clients have? ClientCare got you covered!
ClientCare helps you to manage all your clients' policies and allows you to view what policies your clients have easily.
You can click on "Policy ID" and "Policy Name" to sort the policies by their respective field. Clicking once will sort in ascending order, and clicking again will sort in descending order.
Note: Sorting for both "Policy ID" and "Policy Name" will follow lexicographical order.
ClientCare offers the following commands to help you manage your clients' policies:
addpolicyJust closed a deal?
You can add a policy to a client with addpolicy.
Format: addpolicy INDEX n/POLICY_NAME i/POLICY_ID
INDEX.Examples:
addpolicy 1 n/Life i/1 adds a policy named Life with policy ID 1 to the 1st client in the client list.addpolicy 3 n/Health i/2 adds a policy named Health with policy ID 2 to the 3rd client in the client list.Note: "001" and "1" are not considered duplicated policy IDs as different insurance companies have different numbering schemes.
Note: Although most policy IDs will be up to 25 digits, ClientCare allows you to put up to about 40 digits long before values are truncated in fullscreen. The limit might vary depending on your screen size, so do check if the policy ID is fully displayed.
Before Command:
Suppose you have closed a new policy with Roy. His new policy name is Travel and policy ID is 4123. Roy is number 6 on the client list.
Type the following into the Command Input: addpolicy 6 n/Travel i/4123
After Command:
Roy's new policy has been added! ClientCare shows a success message in the Feedback Display too.
deletepolicyWrong policy or a policy just matured?
You can delete a policy from a client with deletepolicy.
Format: deletepolicy INDEX i/POLICY_ID
INDEX.Examples:
deletepolicy 1 i/1 deletes the policy with policy ID 1 from the 1st client in the client list.deletepolicy 3 i/2 deletes the policy with policy ID 2 from the 3rd client in the client list.Before Command:
Suppose Roy's policy has matured. His policy name is Travel and policy ID is 4123. Roy is number 6 on the client list.
Type the following into the Command Input: deletepolicy 6 i/4123
After Command:
Roy's policy with ID 4123 has been deleted! ClientCare shows a success message in the Feedback Display too.
helpYou can look for help by typing help.
You will see a message explaining how to access the help page.
Format: help
exitDone with all your work? You can exit the program with exit.
Format: exit
No manual saving is required! ClientCare data are saved in the hard disk automatically after any command that changes the data. There is no need to save manually.
ClientCare data is automatically saved as a file [ClientCare file location]/data/clientcare.json. Advanced users are welcome to update data directly by editing that data file.
CAUTION: If your changes to the data file makes its format invalid, ClientCare will discard all data and start with an empty data file at the next run. Hence, it is recommended to take a backup of the file before editing it.
Furthermore, certain edits can cause the ClientCare to behave in unexpected ways (e.g., if a value entered is outside the acceptable range). Therefore, edit the data file only if you are confident that you can update it correctly.
Q : How do I transfer my data to another computer?
 A : Install the app in the other computer and overwrite the empty data file it creates with the file that contains the data of your previous ClientCare home folder.
Q : Why is ClientCare saying my date format is wrong?
 A : Ensure that your date format is in YYYY-MM-DD instead of DD-MM-YYYY.
Q : Why is my client not showing up in Last Met Display?
 A : Check if your client already has an open appointment scheduled. In addition, the default number of days before a client shows up in Last Met Display is 90 days.
This means the last met duration must be 91 days or more.
Q : Where is my 2nd schedule I made for my client?
 A : Currently, ClientCare only allows users to have 1 schedule per client. Scheduling another appointment will overwrite the previous one.
Q : Can I use ClientCare on my tablets or mobile devices?
 A : As of now, no. ClientCare is only supported on Desktop devices that can run Java. Not to worry, mobile device support is currently in development!
Q : Why can ClientCare only be found on GitHub?
 A : GitHub allows ClientCare to be vetted by other users and programmers too. This ensures ClientCare to be up for public scrutiny, so you know ClientCare can be trusted.
Q : I tried following the guides for schedule and met. I encountered errors telling me that the dates are invalid.
 A : The schedule and met commands are time-sensitive. The dates provided in the examples may no longer be relevant.
You can easily change the dates to a future or past date to suit your needs.
Q : I accidentally cleared my data in ClientCare. Can I get my data back?
 A : Unfortunately, you cannot get back your data which has been cleared. In the future, you can consider copying the data folder to save as backup.
Q : A new ClientCare version has been released. Can I use my existing my data on the new version?
 A : Certainly! You just need to copy and overwrite the data folder.
Q : I am not an insurance agent. Is ClientCare still relevant for me?
 A : Sure! You can still use ClientCare to manage all your contact details and personal scheduling affairs. The only features that will be less relevant are those under policies.
Q : Can someone steal my data on ClientCare?
 A : All data in ClientCare is stored only in your own device. Unless you give someone the data folder or has access to your computer, no one can steal your data.
If you are unable to open ClientCare by clicking, here is another way.
For Windows:
powershell into the Address Bar and press ENTER on your keyboardjava -jar clientcare.jarFor macOS:
When using multiple screens, if you move the application to a secondary screen, and later switch to using only the primary screen, the application will open off-screen. The remedy is to delete the preferences.json file created by the application before running the application again.
This refers to electronic devices that ClientCare can run on. This includes devices such as computers and laptops. Mobile devices such as phones and tablets are not supported by ClientCare.
These are things ClientCare can do!
This is the text you type to tell ClientCare what to do!
These are texts that you can click on. They will either bring you to another section in the User Guide or open up the relevant website link. Not to worry, all external website links are from official distributors and are safe!
These are inputs that you can choose! For example: name, phone number, date are all fields you can type into ClientCare.
Java is the programming language that ClientCare is built on! The number 11 refers to Java version. Not to worry! You do not need to know programming to use ClientCare.
This is the number which is assigned to a particular Client. For example, the 3rd client in the list will have the index 3.
This is a whole number. No decimal or fractions is allowed. -7, -1, 0, 7, 14 are all integers. 3.14 or 5/8 are not integers.
This is the place your client lives at.
These are characters that you need to put in front of certain fields. For example, phone numbers have the prefix c/ and
names have the prefix n/. Indexes do not have any prefix in front.
For more information, you can visit our Text Command Introduction for a more comprehensive explanation.
Emails have 2 components. The local-part and the domain. The local-part often refers to the username while domain is where
the email was created from.
For example: mike@gmail.com
mike will be the local-part while gmail.com will be the domain.
This means that the new value added will not be added on top of the existing information. This is especially so for Tags.
For example, if a Client currently has 2 tags friend and important, editing the tags with high will override the previous 2 tags.
The Client will only have the high tag upon a success edit. To preserve all the tags, users must key in all previous tags in addition
to their new tag they wish to add.
This refers to the number of days users can wait and not meet up with the Client before the Client shows up in the Last Met Display.
The default period is 90 days. You can change this value using the set command.
This refers to features or commands in ClientCare that are not related to Client, Schedules or Policies.
If a text is truncated in the display, this means that the full text has been shortened, with an ellipsis ... at the end.
| Action | Format, Examples | 
|---|---|
| Add | add n/NAME c/PHONE_NUMBER e/EMAIL a/ADDRESS d/BIRTHDAY p/PRIORITY [t/TAG]…e.g. add n/James Ho p/22224444 e/jamesho@example.com a/123, Clementi Rd, 1234665 d/1990-01-01 p/medium t/friend t/colleague | 
| Delete | delete INDEXe.g. delete 3 | 
| Edit | edit INDEX [n/NAME] [c/PHONE] [e/EMAIL] [a/ADDRESS] [d/BIRTHDAY] [p/PRIORITY] [t/TAG]…e.g. edit 2 n/James Lee e/jameslee@example.com | 
| List | list | 
| View | view INDEXe.g, view 1 | 
| Find | find KEYWORD [MORE_KEYWORDS]e.g. find James Jake | 
| Remark | remark INDEX [r/REMARK]e.g. remark 3 r/Has 2 school-age children and 1 elderly dependent | 
| Clear | clear | 
| Sort | sort CRITERIA o/ORDERe.g. sort priority o/desc | 
| LastMet | met INDEX d/DATEe.g. met 2 d/2023-05-07 | 
| Set | set NUMBER_OF_DAYSe.g. set 5 | 
| Schedule | schedule INDEX d/DATETIMEe.g. schedule 2 d/2023-05-07 22:00 | 
| Mark | mark INDEXe.g. mark 2 | 
| Add Policy | addpolicy INDEX n/POLICY_NAME i/POLICY_IDe.g. addpolicy 1 n/Life i/1 | 
| Delete Policy | deletepolicy INDEX i/POLICY_IDe.g. deletepolicy 1 i/1 | 
| Help | help | 
| Exit | exit |